Protein Info for Psest_2402 in Pseudomonas stutzeri RCH2

Annotation: Cyclopropane fatty acid synthase and related methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF02353: CMAS" amino acids 138 to 405 (268 residues), 306.6 bits, see alignment E=4e-95 PF13489: Methyltransf_23" amino acids 185 to 310 (126 residues), 35.2 bits, see alignment E=2.5e-12 PF08241: Methyltransf_11" amino acids 199 to 295 (97 residues), 41.7 bits, see alignment E=3.8e-14 PF13649: Methyltransf_25" amino acids 199 to 292 (94 residues), 48.2 bits, see alignment E=3.6e-16 PF08242: Methyltransf_12" amino acids 199 to 293 (95 residues), 32.8 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 88% identity to psa:PST_1959)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNM5 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Psest_2402 Cyclopropane fatty acid synthase and related methyltransferases (Pseudomonas stutzeri RCH2)
MKSPSLTVKAHPLAGKGLASGLLRRMVLRQLEKLRHGQLTLRFGGECQLFGDLASPLQAE
IHVVDGAAWGLIAARGSIGAGEAYIHGYWHSPDLTAVIRLFVANLDVLDSIERGSLALFG
QPVIKALHWLNRNTRAGSQRNIAAHYDLGNELFEQFLDPTMMYSAAMFTSPEQDLEQAQL
NKLERICEKLDLQPDDHLLEIGTGWGSMALYAAARYGCRVTTTTLSREQFAYTQQRIEKQ
GLQDRITLLLKDYRDLEGQFDKLVSIEMIEAVGHDFLPTYFRQCSRLLKDDGLMLLQAIT
IRDQRYEQARRNVDFIQRYIFPGGALPSLQRMLNVASQDTDMNLLHMEDFGEHYARTLRL
WHENFRRARSELERHGYDDYFYRLWEFYLCYCEGGFIERAIGTAQLLLAKPDARRKPLYA
GSSGSNGNR