Protein Info for HP15_2297 in Marinobacter adhaerens HP15

Annotation: response regulator receiver modulated CheB methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00072: Response_reg" amino acids 2 to 81 (80 residues), 57.9 bits, see alignment E=1.1e-19 PF01339: CheB_methylest" amino acids 174 to 353 (180 residues), 206.8 bits, see alignment E=2.2e-65

Best Hits

Swiss-Prot: 64% identical to CHEB4_HAHCH: Protein-glutamate methylesterase/protein-glutamine glutaminase 4 (cheB4) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 80% identity to maq:Maqu_1971)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGF0 at UniProt or InterPro

Protein Sequence (358 amino acids)

>HP15_2297 response regulator receiver modulated CheB methylesterase (Marinobacter adhaerens HP15)
MVGAATNGREGVELAEKLRPDVITMDYEMPVMDGISAVREIMRKHPIPVLMFSSLTYEGA
RVTLDALEAGAVDFLPKNFEEIARDNSQLQKILIERILDVARSRPGNRSPAPSRAEPSTP
ASRAPEPAGRPRPEPAPRQRPDTRAPAAPAGSPGETEAPRRHGRRGPAKHYAVVGIGTST
GGPVALQRVLTVLPATFPAPIVLVQHMPASFTPAFAERLNKLCRIEVRQAEDGDVLRPGL
ALLAPGGKQMMVENRGGQARIRILPGDERLNYKPCVDVTFGSLARSFPGKTLGVILTGMG
SDGKEGCRMMKQSGSDIWSQDEKSSVIYGMPMAVAKAGLTDDVLSLDEIGPRLAEGVC