Protein Info for HP15_2296 in Marinobacter adhaerens HP15

Annotation: chemotaxis protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF20560: MotA_N" amino acids 9 to 69 (61 residues), 31.1 bits, see alignment E=2.3e-11 PF01618: MotA_ExbB" amino acids 105 to 217 (113 residues), 106.1 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 31% identical to MOTA_HELPJ: Motility protein A (motA) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 92% identity to maq:Maqu_1970)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGE9 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HP15_2296 chemotaxis protein MotA (Marinobacter adhaerens HP15)
MLMDILSLLGVILAFAAILGGNLLEGGAVGSLFNGPAAIIVIGGTLAATILQTSWPMLKR
AFTQVRWVFFPPFINLEDGIGKVIDWSVKARKQGLLGLEGLAEREPEPFARKGLQLLVDG
AETETIRGIMEVDLESREQRDLESAKVFEAMGGYSPTIGIIGAVMGLIQVMTNLEDPQSL
GSGIATAFVATIYGVALANLLFFPVANKMRGIVRERTRYEDMMIDGLIAIAEGENPKSIE
LRLRGFLQ