Protein Info for HP15_2294 in Marinobacter adhaerens HP15

Annotation: chromosome partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF13614: AAA_31" amino acids 10 to 188 (179 residues), 154.5 bits, see alignment E=1.2e-48 PF10609: ParA" amino acids 11 to 158 (148 residues), 30.7 bits, see alignment E=8.8e-11 PF01656: CbiA" amino acids 13 to 237 (225 residues), 71.8 bits, see alignment E=2.1e-23 PF09140: MipZ" amino acids 13 to 49 (37 residues), 21 bits, see alignment 7.3e-08 PF06564: CBP_BcsQ" amino acids 14 to 163 (150 residues), 30.8 bits, see alignment E=8.5e-11 PF02374: ArsA_ATPase" amino acids 17 to 58 (42 residues), 31.8 bits, see alignment 3.6e-11 PF00142: Fer4_NifH" amino acids 18 to 179 (162 residues), 30.3 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 32% identical to SOJ_BACSU: Sporulation initiation inhibitor protein Soj (soj) from Bacillus subtilis (strain 168)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 89% identity to maq:Maqu_1968)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGE7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>HP15_2294 chromosome partitioning protein ParA (Marinobacter adhaerens HP15)
MYSLENQSVRIWAVANQKGGVGKTTSVVALGGLLAERGKRVLVVDLDPHGSLTSWFGYDP
DTIAHSVFDLFQHQGKVPEGLPAQLITEASCKGLSLLPASAALATLERRMIGVEGMGLII
SRALTQLWDDFDYVLLDNTPSLGVLMVNALAAAQHLIIPVQTEFLAIKGLERMLHTLKMI
MRSQKNELSYTIVPTLYDRRTQASVKSLNLLRKTYRESLWQFAIPVDTKFRDASQGGITP
SALDAETHGVRAYSHLLDDLMARVGRVKERQHG