Protein Info for Psest_2391 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00229: PAS domain S-box protein" amino acids 5 to 126 (122 residues), 61.6 bits, see alignment E=4.2e-21 PF13188: PAS_8" amino acids 6 to 61 (56 residues), 37.2 bits, see alignment E=4.9e-13 PF00989: PAS" amino acids 7 to 116 (110 residues), 47.4 bits, see alignment E=4.5e-16 PF08448: PAS_4" amino acids 12 to 122 (111 residues), 26.1 bits, see alignment E=2.2e-09 PF13426: PAS_9" amino acids 16 to 121 (106 residues), 78.7 bits, see alignment E=8.9e-26 PF08447: PAS_3" amino acids 31 to 115 (85 residues), 42.1 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_1970)

Predicted SEED Role

"putative PAS/PAC sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJI2 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Psest_2391 PAS domain S-box (Pseudomonas stutzeri RCH2)
MINAKLLQLVIEASNDGIVVAEQEGDDNILIYANPAFERLTGYAVDDILYRDCRFLQGED
RDQAGLQAIREAVKSNQPCRQIIRNYRKDGTPFWNELSITPVFNEADQLTYFIGIQKNVT
AEVDALQRVEALEAEIRDLKAQLARTQG