Protein Info for PGA1_c23740 in Phaeobacter inhibens DSM 17395

Annotation: ribose-5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00021: ribose 5-phosphate isomerase A" amino acids 12 to 232 (221 residues), 263.3 bits, see alignment E=7.3e-83 PF06026: Rib_5-P_isom_A" amino acids 57 to 231 (175 residues), 210.2 bits, see alignment E=8.3e-67

Best Hits

Swiss-Prot: 86% identical to RPIA_RUEST: Ribose-5-phosphate isomerase A (rpiA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 86% identity to sit:TM1040_1960)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.6

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2S6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PGA1_c23740 ribose-5-phosphate isomerase A (Phaeobacter inhibens DSM 17395)
MTGELSPIDKAKFVAAKRAAEMVEDGMRVGLGTGSTAAWLVRCLGDMVQNDGLRIKGVPT
STRTAELARDVGIETLTLDEAKWLDLTIDGADEFDRDLNLIKGGGGALLQEKIVATASDR
MVVIADKAKEVESLGAFPLPVEVIPFGWQTTQALLEETLVAMEVMGRKTTLRMNGDAALV
TDEGNHILDLHLNRIGNVRQMALVLNQIPGVVENGLFIDICDTVVVGYGDGKVEVRDINE
GTVETDRLDFVESENLFTDLSD