Protein Info for HP15_233 in Marinobacter adhaerens HP15

Annotation: molybdenum cofactor biosynthesis protein B-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02667: molybdenum cofactor biosynthesis protein B" amino acids 9 to 168 (160 residues), 247 bits, see alignment E=7e-78 TIGR00177: molybdenum cofactor synthesis domain" amino acids 12 to 152 (141 residues), 115.2 bits, see alignment E=2.4e-37 PF00994: MoCF_biosynth" amino acids 16 to 156 (141 residues), 97.5 bits, see alignment E=3.1e-32

Best Hits

Swiss-Prot: 58% identical to MOAB_ECO57: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli O157:H7

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 79% identity to maq:Maqu_0480)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK66 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HP15_233 molybdenum cofactor biosynthesis protein B-like protein (Marinobacter adhaerens HP15)
MSSVPSTEMKPLNVALLTVSDTRGPEQDTSGQFLEDSVVEAGHNLVARRILPDDVYLVRA
LLSGWIADSQVHAVIITGGTGLLERDSTPEAVRPLLDKTIEGFGEEFRRLSAAEIGSSTV
QSRAMAGMANHTVIFCLPGSTGACRTGWEGILLSQLDSRHTPCNFAGLVLRKPEKPMSRL
NEVIGQRAKR