Protein Info for PGA1_c23630 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00989: PAS" amino acids 25 to 118 (94 residues), 29.1 bits, see alignment E=2.6e-10 PF13188: PAS_8" amino acids 26 to 78 (53 residues), 31.6 bits, see alignment E=3.4e-11 TIGR00229: PAS domain S-box protein" amino acids 32 to 116 (85 residues), 50.1 bits, see alignment E=1.5e-17 PF13426: PAS_9" amino acids 33 to 117 (85 residues), 40.2 bits, see alignment E=1e-13 PF08447: PAS_3" amino acids 47 to 117 (71 residues), 33.3 bits, see alignment E=1.5e-11 PF00196: GerE" amino acids 140 to 192 (53 residues), 65.5 bits, see alignment E=7.9e-22 PF08281: Sigma70_r4_2" amino acids 142 to 184 (43 residues), 35.2 bits, see alignment 2.3e-12

Best Hits

KEGG orthology group: None (inferred from 74% identity to sil:SPO1346)

Predicted SEED Role

"transcriptional regulator, LuxR family/sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EP34 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PGA1_c23630 putative transcriptional regulator (Phaeobacter inhibens DSM 17395)
MTAQPPQTHPSPETLDQLFANRDLMRLAYDFLPVGIVVTENRVLRDCNRRFCEIFGYPRA
ELLDQLFAFLYPSEEEFLNLRSRGDDTLGTGAPYWDERVMRRKDGSLFWVRVRGHSFTPE
DPLARAVWSFADLSRSRPYQPLTRREREVYSLLCEGKTSKEIARSLGLSYRTVEVHRARL
LKKMGVSNTAALFSSLGDIDGDHVVGSAEP