Protein Info for PGA1_c23620 in Phaeobacter inhibens DSM 17395

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details PF25539: Bestrophin_2" amino acids 1 to 273 (273 residues), 282.5 bits, see alignment E=2.3e-88

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 57% identity to rcp:RCAP_rcc02178)

Predicted SEED Role

"probable membrane protein STY1534"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYS1 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c23620 Predicted membrane protein (Phaeobacter inhibens DSM 17395)
MILRDKPGLMQLLFAVRGSVLPRILPRILGLSALSALVLWIDANVLPLPHTNAAPFAVFG
IALSLFLGFRNNAAYDRWWEGRRLWGQLVADLRSLSREVDLFVADPDRRAQILRLALGFL
HLHRINLRKETDTTPAIRWAGDDFSGSPHAPCAALDALAATVALGADDGFARKALAERTA
SIALAQAGCERIATTPLPYVYSLLVFRTTYLYCLLLPFALIDGAGWLTPIFVGIVAYVFF
GLAEVTEELSHPFGETVNGLPLDAICRTVERALAPKLGQDAPPPLQPVDYYLS