Protein Info for PGA1_c23540 in Phaeobacter inhibens DSM 17395

Annotation: O-succinylhomoserine sulfhydrylase MetZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 9 to 391 (383 residues), 428.7 bits, E=3.1e-132
• TIGR01325: O-succinylhomoserine sulfhydrylase
  • amino acids 9 to 391 (383 residues), 554.8 bits, E=3.8e-171
• PF00155: Aminotran_1_2
  • amino acids 56 to 209 (154 residues), 45.2 bits, E=1.6e-15
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 183 (122 residues), 22.1 bits, E=1.6e-08
• PF00266: Aminotran_5
  • amino acids 83 to 210 (128 residues), 36.5 bits, E=5.8e-13

Best Hits

Swiss-Prot: 54% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 88% identity to sit:TM1040_1938)

MetaCyc: 48% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49)" in subsystem Methionine Biosynthesis (EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (3/5 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Cysteine metabolism
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Selenoamino acid metabolism
• Sulfur metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See I7E2Q6 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PGA1_c23540 O-succinylhomoserine sulfhydrylase MetZ (Phaeobacter inhibens DSM 17395)
MSETWNKRTKLVHGGTRRSQYNEVSEAIYLTQGFVYDTAEQAEARFIETGPDEFIYARYG
NPTVAMFEERIAALEGAEDAFATASGMAAVNGALTSILKAGDHVVSAKALFGSCLYILEN
ILTRYGVEVTFVDGTDLDAWRAALRPDTKAVFFESMSNPTLEVIDIAAVAELAHAVGATV
VVDNVFSTPVFSNAIEQGADVVIYSATKHIDGQGRVLGGVILGTRDFIRGTVEPYMKHTG
GSLSPFNAWTLLKGLETISLRVNAQAETALELAQALSGHPALSRLMYPGLEDHAQHALVQ
RQLGGKGGTVLSLDLKGGKDAAFRFLNALTIPVISNNLGDAKSIATHPATTTHQRLSEEL
KSELGITPGLVRFSVGLEDAGDLIADLTQALAVAEG