Protein Info for PGA1_c23530 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF02649: GCHY-1" amino acids 76 to 341 (266 residues), 236.3 bits, see alignment E=2.1e-74

Best Hits

Swiss-Prot: 81% identical to GCH4_RUEST: GTP cyclohydrolase FolE2 (folE2) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K09007, hypothetical protein (inferred from 81% identity to sit:TM1040_1937)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EP23 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PGA1_c23530 Uncharacterized conserved protein (Phaeobacter inhibens DSM 17395)
MNSHSRNLTKAPDRADAEDALDLLRKWASTATETEIAQLNPAVARLLPNSPVGNYPDLSR
HYPEEFEADSSYRATLPDLQNGPSSLIRGAHEQIQHVGISNFRLPIRFHTRDNGDLTLET
SVTGTVSLDADKKGINMSRIMRSFYKHAERTFSFEVMEAALDDYLTDLESLDARLQMRFS
FPVKIESLRSGLSGYQYYDIALEIVDHDGERTKIIHLDYVYSSTCPCSLELSEHARSARG
QLATPHSQRSVARISLVQEPGAPVLWFEDVIDHCRRAVPTETQVMVKREDEQAFAELNAA
NPIFVEDAARLFCEALQSDPRIGDFRVVASHQESLHSHDAISVLTQGPTFAARSIDPKMF
ATLIHQG