Protein Info for Psest_2368 in Pseudomonas stutzeri RCH2

Annotation: ABC transporter periplasmic binding protein, urea carboxylase region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03427: ABC transporter periplasmic binding protein, urea carboxylase region" amino acids 28 to 354 (327 residues), 511.9 bits, see alignment E=3.5e-158 PF13379: NMT1_2" amino acids 37 to 246 (210 residues), 34.5 bits, see alignment E=2.1e-12 PF09084: NMT1" amino acids 59 to 237 (179 residues), 32.4 bits, see alignment E=9e-12

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 97% identity to psa:PST_1992)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, periplasmic substrate-binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLM0 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psest_2368 ABC transporter periplasmic binding protein, urea carboxylase region (Pseudomonas stutzeri RCH2)
MHGTMKKLFCAGAIALAALSPFAQAEEKKTFNLAWTIYVGWMPWKYADESGIMKKWADKY
GIEVNISQINDYVESINQYSAGQFDGVVATSMDALSIPAAGGVDTTALIVGSYSNGNDGL
VMKGTDDLKQIKGQQVHLVELSVSHYILAKALDSVGLSEKDVKVVNTSDADIVAAFSTAD
VRNVATWSPLLQEVAAAPDAHQVFDSASVPGHVKDLLIVNSETLADNPAFGKAVTGAWYE
VMAIMASDTPEGAELRAQLGAASGTDQAGYEAQLKGTHMFYQPAEAIAFISGEPAHEAMD
SVRKFSFDHGLLGDGADSADFVGIAMPAGSLGDQGNLKLRFDTSYMQMAADGAL