Protein Info for PGA1_c23510 in Phaeobacter inhibens DSM 17395

Annotation: aspartokinase LysC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 3 to 408 (406 residues), 418.3 bits, E=3.4e-129
• PF00696: AA_kinase
  • amino acids 3 to 231 (229 residues), 153.7 bits, E=1.4e-48
• TIGR00657: aspartate kinase
  • amino acids 62 to 407 (346 residues), 380.2 bits, E=1.6e-117
• PF01842: ACT
  • amino acids 272 to 329 (58 residues), 46.7 bits, E=4.3e-16
• PF22468: ACT_9
  • amino acids 273 to 326 (54 residues), 40.3 bits, 4.2e-14
  • amino acids 348 to 406 (59 residues), 88.4 bits, E=4.2e-29
• PF13840: ACT_7
  • amino acids 342 to 404 (63 residues), 68.3 bits, E=8.4e-23

Best Hits

Swiss-Prot: 54% identical to AKLYS_PSEU5: Aspartate kinase Ask_LysC (lysC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 92% identity to sit:TM1040_1934)

MetaCyc: 52% identical to aspartokinase (Halomonas elongata DSM 2581)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of L-threonine biosynthesis (5/6 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See I7F156 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PGA1_c23510 aspartokinase LysC (Phaeobacter inhibens DSM 17395)
MPVLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYNVIVIVSAMSGKTNELVGWVNETSPL
FDAREYDAVVSSGENVTAGLMALTLQEMDIPARSWQGWQVPLKTTSAHSQARIEEIPPEN
INAKFGEGMRVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY
TTDPRICDKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA
GTLVCDEEEIMESNVVAGVAYSRDEAKLTVQSVADRPGIAAHIFTALSEAGVNVDMIVQD
ISDEGRTDMTFSCPTDQVVRAEQALQAVKEKGELNYAELLADRDVAKVSVVGIGMRSQSG
VAAKMFKVLSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA