Protein Info for PGA1_c23500 in Phaeobacter inhibens DSM 17395

Annotation: phosphoenolpyruvate-protein phosphotransferase PtsP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 PF01590: GAF" amino acids 28 to 158 (131 residues), 56.1 bits, see alignment E=1.8e-18 PF13492: GAF_3" amino acids 30 to 158 (129 residues), 27.6 bits, see alignment E=1.1e-09 PF13185: GAF_2" amino acids 30 to 159 (130 residues), 51.3 bits, see alignment E=4.4e-17 PF05524: PEP-utilisers_N" amino acids 184 to 302 (119 residues), 72.2 bits, see alignment E=1.4e-23 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 200 to 725 (526 residues), 392.7 bits, see alignment E=1.3e-121 PF00391: PEP-utilizers" amino acids 329 to 400 (72 residues), 63.8 bits, see alignment E=2.6e-21 PF02896: PEP-utilizers_C" amino acids 427 to 715 (289 residues), 289.7 bits, see alignment E=7e-90

Best Hits

KEGG orthology group: K08484, phosphotransferase system, enzyme I, PtsP [EC: 2.7.3.9] (inferred from 86% identity to sit:TM1040_1933)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase, nitrogen regulation associated"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2Q1 at UniProt or InterPro

Protein Sequence (746 amino acids)

>PGA1_c23500 phosphoenolpyruvate-protein phosphotransferase PtsP (Phaeobacter inhibens DSM 17395)
MVKTTESESRNLLMRLREAMAGDDAGQARLDKITQLIADSMQSEVCSVYLFRDDETLELC
ATQGLNVESVHQTRMRIGEGLVGRVARYGKVINTPDAPNAKGFRYMPETGEERFSSFLGV
PIQRLGEMLGVLVVQSKEGREFSSDAVYALEVVAMVIAEMTELGAFVGEGAALSPLHQQP
VLMRGTIAQEGAVEGHVWLHEPRVVVTNPIADDPHRELERLHEAVEELRVGVDKMLEVTQ
TGDKEQLQVLEAYRMFANSKGWMRRMEEDIGRGLSAEAAVEKEQSQARARMGQVQDAYLR
ERLSDLDDLSNRLLRILTGQGSETGAELPEDPVLIARNIGPGELLEYGRNLRGIVLEEGS
VGSHAAIIARALAIPLVVHTKRITTEALNGDHIMVDGEQGVVHLRPDDTVVSAFRDKIAM
QAKAQERYASIRDKQALTRDGRRVHLLMNAGLMADLPSLENSGAEGVGLFRTELQFLVRN
QMPKRSELVALYQRVLDAAGGKRVVFRTLDIGSDKVLPYMKPTDEPNPALGWRAIRVGLD
KPGVMRMQLQALIRAANGRPLTVMFPFVAQFEEFRDAKAEVEKTLERERRLGHALPEKLE
VGAMLETPSLAFAPQKFFDEVEFLSIGGNDLKQFFFAADRENERVRKRYDTLNVSYLSFI
AQIVERCEKSGTPLSFCGEDAGRPIEAVCLAAMGLRVLSMRPASVGPVKSLLMRVDLNDI
RKIIADARHRGEQTVRPAVMQYLREL