Protein Info for Psest_2364 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 286 (170 residues), 95.5 bits, see alignment E=1.6e-31

Best Hits

Swiss-Prot: 38% identical to Y3424_BRUAB: Probable ABC transporter permease protein BruAb2_1124 (BruAb2_1124) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to psa:PST_1995)

MetaCyc: 33% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM67 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Psest_2364 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Pseudomonas stutzeri RCH2)
MTAQISIPSAASAAQQTQPPAPAAPAEQVVRKSSFWRIRGEISRRSAWLLTGAGLSLPFV
VWWLWTALGLADPMFMPSPGAVLERIGRWWTSEGLLGDIGISVWRVMAGFGASALIALPL
GLYIGTYRPVQAFLEPLTDFIRYMPAVAFIPLVMLWVGIDEGSKVLIIFIGTFFQMVLMV
AEDVRRVPMAQIEAAQTMGANRGEIVKLVILPSAKPALLDTLRITCGWAWTYLVVAELVA
ANSGLGYAILKAQRYMHTDKIFAGILLIGLIGLLTDQAFRWLHRRAFPWMRK