Protein Info for PGA1_c23480 in Phaeobacter inhibens DSM 17395

Annotation: putative D-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 13 to 195 (183 residues), 187.2 bits, see alignment E=6.2e-59 PF01370: Epimerase" amino acids 14 to 243 (230 residues), 21.3 bits, see alignment E=4e-08 PF08659: KR" amino acids 14 to 170 (157 residues), 59.7 bits, see alignment E=9.2e-20 PF13561: adh_short_C2" amino acids 21 to 255 (235 residues), 185.1 bits, see alignment E=4e-58

Best Hits

KEGG orthology group: None (inferred from 64% identity to sit:TM1040_2242)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYQ7 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c23480 putative D-beta-hydroxybutyrate dehydrogenase (Phaeobacter inhibens DSM 17395)
MSNLAGKDLAGRHVVVTGGGSGVGAALARSFAGGGARLTLLGRRIEPLQEVAAETGALPL
ACDVTEAEAVRAALDTARQQHGPVSVAIANAGAAPSKPFAKMDLADFEAALAVNLSGVFN
LWQAALPDMKSAGWGRMIAVASTAGLKGYPYVSGYCAAKHGVVGLTRSLAQELARSGITV
NAICPGFIETPLLERSIATIVSTTGMSEEEAAKSLRAGNPQGRFIQPEEVADAALFLASS
SAASINGSALPITGGEI