Protein Info for Psest_2360 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein, putative amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR04448: creatininase" amino acids 7 to 251 (245 residues), 385.3 bits, see alignment E=6.7e-120 PF02633: Creatininase" amino acids 7 to 247 (241 residues), 208.5 bits, see alignment E=5.3e-66

Best Hits

Swiss-Prot: 51% identical to CRNA_PSEPU: Creatinine amidohydrolase (crnA) from Pseudomonas putida

KEGG orthology group: K01470, creatinine amidohydrolase [EC: 3.5.2.10] (inferred from 93% identity to psa:PST_1998)

MetaCyc: 51% identical to creatininase subunit (Pseudomonas putida)
Creatininase. [EC: 3.5.2.10]

Predicted SEED Role

"Creatinine amidohydrolase (EC 3.5.2.10)" (EC 3.5.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJF3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psest_2360 Uncharacterized protein, putative amidase (Pseudomonas stutzeri RCH2)
MSVHMDQLSWVEYERRIGEGAVVFLPCGATEQHGPHLPLGTDALMASAISAEVAARVGGL
VAPALSYGYKSQPKCGGGQHFCGTTSLDGATLSALVRDAVREFHRHGVRRLVLVLGHYEN
QWFVAEGIQLALRDLGPDAGLEVMRLEHWDFCREQTLTDVFPDGFPGFALEHAAVIETSL
MLHFHPQLVALEKIPDDAPADFPPYDMYPSRTQWVPPSGVLSSAKGSSAEKGQRLAEDIV
DGIAAAVCKEFAL