Protein Info for PGA1_c23440 in Phaeobacter inhibens DSM 17395

Annotation: putative benzoate-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 48 to 397 (350 residues), 248.6 bits, E=9.3e-78
• PF13193: AMP-binding_C
  • amino acids 451 to 529 (79 residues), 76.4 bits, E=2.8e-25

Best Hits

KEGG orthology group: K08295, 2-aminobenzoate-CoA ligase [EC: 6.2.1.32] (inferred from 85% identity to sil:SPOA0401)

MetaCyc: 55% identical to aerobic 2-aminobenzoate-CoA ligase type I (Aromatoleum evansii)
Anthranilate--CoA ligase. [EC: 6.2.1.32]

Predicted SEED Role

"Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases"

MetaCyc Pathways

• anthranilate degradation II (aerobic) (2/2 steps found)
• anthranilate degradation III (anaerobic) (1/2 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (3/5 steps found)
• aurachin RE biosynthesis (1/5 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (3/10 steps found)
• 2-heptyl-3-hydroxy-4(1H)-quinolone biosynthesis (1/8 steps found)
• aurachin A, B, C and D biosynthesis (3/11 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (4/27 steps found)

KEGG Metabolic Maps

• Acridone alkaloid biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Carbazole degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.32

Sequence Analysis Tools

See I7EP14 at UniProt or InterPro

Protein Sequence (538 amino acids)

>PGA1_c23440 putative benzoate-CoA ligase (Phaeobacter inhibens DSM 17395)
MLGPSAHTDTFTRDNLPPVDQWPEFLTDGYDYPERLNAAVELTDAMVAKGFGDHTALIGN
GRRRTYKELTDWTNRLAHVLVEDLGVQPGNRILIRSANNPAMVACWLAATKAGAVVVNTM
PMLRAGELAKIIDKAEISHALCDTRLMEELVACAKTSAHLKSVVGFDGTSNHDAELDRLA
LEKPVRFEAVATGRDDVALLGFTSGTTGSPKATMHFHRDLLMIADGYAAEVLQVTPEDIF
VGSPPLAFTFGLGGLAIFPLRFGAAATLLENASPPNLIEIIETYKATVCFTAPTAYRVML
RAMEEGADLSSLRAAVSAGETLPAPVYDEWIAQTGKPMLDGIGATEMLHIFISNRFDDHR
PACTGKPVKGYRVRVLDSDGNEAPRGEVGRLAVKGPTGCRYLADARQGEYVKDGWNITGD
SFVMDVDGYLHFAARNDDMIVSAGYNIAGPEVEAALLSHDLVTECAVIGASDDARGEIVQ
AHVVLAEGAQASEVLTRALQDHVKAAIAPYKYPRDIVYTDALPKTETGKIQRFRLKST