Protein Info for Psest_2343 in Pseudomonas stutzeri RCH2

Annotation: Mg-dependent DNase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to TATD_ENTLS: 3'-5' ssDNA/RNA exonuclease TatD (tatD) from Enterobacter lignolyticus (strain SCF1)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 86% identity to psa:PST_2013)

Predicted SEED Role

"Deoxyribonuclease TatD" in subsystem Twin-arginine translocation system or YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNG9 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psest_2343 Mg-dependent DNase (Pseudomonas stutzeri RCH2)
MQLIDIGVNLTHPTFAANPAAVVERAKAAGVVQMVLTGTSLAESEAALGLCRELDESGQR
LFSTAGVHPHDASQWSTDSAGQLRGLLREPPVRAVGECGLDFNRDFSPRPQQERALEEQL
QLAVELQLPVFLHERDASERLAAILRPFRDHLKAAVVHCFTGEKAALYAYLDLDLHIGIT
GWICDERRGTHLHPLVRDIPEGRLMLESDAPYLLPRSLRPKPKSGQNEPAYLPEVLREVA
QHRGESADQLAEHTTRCARSFFGLPDLD