Protein Info for PGA1_c23270 in Phaeobacter inhibens DSM 17395

Annotation: amino acid transport sytem, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 37 to 281 (245 residues), 342.3 bits, see alignment E=1.8e-106 PF00005: ABC_tran" amino acids 45 to 192 (148 residues), 118.4 bits, see alignment E=3.6e-38

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 62% identity to mci:Mesci_5138)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSG8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PGA1_c23270 amino acid transport sytem, ATP-binding protein (Phaeobacter inhibens DSM 17395)
MTPKTKLSCRNIWKLYGANAEAFLNANPTPSGEDIRKAGIIGAVRDARIDIAEGEIFIIM
GLSGSGKSTLVRCLSRLIEPTGGQVLFDGVDLLTASEQELIEIRRHKMGMVFQHFALLPH
LTVLQNVMFPLTVQAVPKSEAEVKAREVVELVGLKGREDYYPRELSGGQQQRVGIARSLV
TEPDLWFLDEPFSALDPLIRREMQDEFLRLQARLHKTIVFITHDFEEAVRLADRIAIMKD
GHIIQIATPEELVLNPATDYVAEFTRHIPRSKVLTVGGIMASGTDGEGTPVPQTARVSDV
AEQIIAADAPRPVCDDSGRIIGSINRQAVARVLFGAGETSGGIE