Protein Info for HP15_2241 in Marinobacter adhaerens HP15

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 4 to 315 (312 residues), 462.5 bits, E=3.9e-143
• PF00923: TAL_FSA
  • amino acids 14 to 312 (299 residues), 316.9 bits, E=6.3e-99

Best Hits

Swiss-Prot: 85% identical to TAL_MARHV: Transaldolase (tal) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 85% identity to maq:Maqu_1919)

MetaCyc: 63% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• pentose phosphate pathway (7/8 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (9/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

See E4PFT5 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HP15_2241 transaldolase (Marinobacter adhaerens HP15)
MTSKLDQLKTMTTVVADTGDIEAIAKWRPEDATTNPSLLLKAAASDAYRPMLDKAVAEAR
RHGGSDAEQLTMATDMLAVLAGREILNLIPGVVSTEVDARLSFDTAGTLERARRLVELYD
KQGVDTSRVLIKIASTWEGIRAAEQLEKEGIHCNLTLLFSFIQAAACAQAGAFLISPFVG
RILDWHLASTGRDTYPAAEDPGVLSVSRIYNYYKANGFKTVVMGASFRNTGEIEMLAGCD
RLTISPTLLQELQDDPGDLPRRLVADTASSPDQFGTIDEKLFRWESNEDAMATEKLADGI
RRFTADQIELENRVRQLARAA