Protein Info for PGA1_c23150 in Phaeobacter inhibens DSM 17395
Annotation: acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to ACOB_BACSU: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta (acoB) from Bacillus subtilis (strain 168)
KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 55% identity to bha:BH0777)MetaCyc: 45% identical to pyruvate dehydrogenase E1 component beta subunit (Homo sapiens)
Predicted SEED Role
"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)
MetaCyc Pathways
- TCA cycle III (animals) (9/10 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
- pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
- pyruvate fermentation to acetate II (3/3 steps found)
- TCA cycle I (prokaryotic) (8/10 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- superpathway of glyoxylate bypass and TCA (9/12 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
- pyruvate fermentation to acetate V (2/3 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Butanoate metabolism
- Citrate cycle (TCA cycle)
- Glycolysis / Gluconeogenesis
- Pyruvate metabolism
- Valine, leucine and isoleucine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 1.2.4.1
Use Curated BLAST to search for 1.2.4.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7E2L9 at UniProt or InterPro
Protein Sequence (331 amino acids)
>PGA1_c23150 acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta (Phaeobacter inhibens DSM 17395) MREITLSQAVNEALAEEMRRDETVFIIGEDVAEAGTPFKVLSGLVEEFGTERVVDTPIAE PGFMGLAVGAAMTGTRPVVDLMFGDFIYLIMDQLCNQAAKTHYMSGGKMSAPLVLRTNMG ATRRSAAQHSQSLHALVAHIPGLKVAMPSSAYEAKGLMKTAIRDNNPVVIFEDKLMYNDK APVPEEEFLIPFGEANIKRAGNDITLIATSSMVQVCEAAAEILAKEGIDAEVIDPRTIVP LDEETLIASAKKTSRVIVVDEGHQSYGITGEIAGRINEKAFYHLDAPVLRMGAMDVPVPF SPALEDITVPTPEAVAANARKLMSGEMIHAA