Protein Info for PGA1_c23090 in Phaeobacter inhibens DSM 17395

Annotation: putative acetoin(diacetyl) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 34% identical to GOLD_LISIN: NAD-dependent glycerol dehydrogenase (golD) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 53% identity to pde:Pden_4982)

Predicted SEED Role

"2,3-butanediol dehydrogenase, S-alcohol forming, (S)-acetoin-specific (EC 1.1.1.76)" in subsystem Acetoin, butanediol metabolism (EC 1.1.1.76)

MetaCyc Pathways

(S,S)-butanediol biosynthesis (1/1 steps found)
(S,S)-butanediol degradation (1/1 steps found)
superpathway of 2,3-butanediol biosynthesis (3/6 steps found)

KEGG Metabolic Maps

Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENX9 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PGA1_c23090 putative acetoin(diacetyl) reductase (Phaeobacter inhibens DSM 17395)
MGRVSGRSCIVTGAAQGIGRAIAEALLDEGASVCFADINGIKVAEVASLNRSTHGESRVT
HAQVDVTDRETVRALIDHTVAMFGKLDVKFNNAGVNKPMNFLDVTEENWRFVNDVNGLGC
LIGMQEAAKQFIRQGTFGKIINTASIASRQGFDNVAPYCASKFGVVALTQSGARDLAKHN
ITVTGFAPGVVDTEMWEQVDQDLMDIGAAERPGQAMEEFSADILKGRVAKPQDITGTTTF
LAAPDSDYMTGQIVMIDGGMTLV