Protein Info for HP15_2226 in Marinobacter adhaerens HP15

Annotation: SH3, type 3 domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details transmembrane" amino acids 183 to 204 (22 residues), see Phobius details TIGR04211: SH3 domain protein" amino acids 17 to 213 (197 residues), 208.1 bits, see alignment E=5.1e-66 PF08239: SH3_3" amino acids 24 to 76 (53 residues), 43.3 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K07184, SH3 domain protein (inferred from 78% identity to maq:Maqu_1880)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFS0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>HP15_2226 SH3, type 3 domain protein (Marinobacter adhaerens HP15)
MLFAVSSIAVAQAKTVWVDDQLYLPVRSGAGSQFRIIENAVPSGTPLEVIEASDSGYTLV
RTPKGTEGWVSSQYLSETPIAADRLRTANRQLEETRAELAQAKEQLSNVVTERNALESSE
ASLSDRSQELQEELQRIKSIAADSINLERRNRELREENQKIRNDLEVLTAENERLEASKE
YDFMLLGAGLVLGGVLLALIIPMLKPTRKTDNWA