Protein Info for HP15_2221 in Marinobacter adhaerens HP15

Annotation: pseudouridine synthase, RluA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00005: pseudouridine synthase, RluA family" amino acids 47 to 343 (297 residues), 277 bits, see alignment E=9.2e-87 PF01479: S4" amino acids 51 to 97 (47 residues), 35.4 bits, see alignment 7.3e-13 PF00849: PseudoU_synth_2" amino acids 132 to 279 (148 residues), 101.9 bits, see alignment E=4e-33

Best Hits

Swiss-Prot: 54% identical to RLUC_PSEAE: Ribosomal large subunit pseudouridine synthase C (rluC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 80% identity to maq:Maqu_1875)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFR5 at UniProt or InterPro

Protein Sequence (352 amino acids)

>HP15_2221 pseudouridine synthase, RluA family (Marinobacter adhaerens HP15)
MSRKSASRKPAQPRPERAKNTSRAGSESQAVRGEVRQGVQWVTVDEDNEGQRVDNFLLAQ
LRGVPKSIIYRVIRKGEVRVNKGRVKPDSRVRTGDQVRIPPITRKEKPDQVAPGSRVQGV
MESAVVFENEQMLVVNKPSGIAVHGGSGLSFGLIEVLRSARPTAKFLELVHRLDRDTSGL
IMVAKKRSALRYLQDELRQKRIRKHYHALVAGDWPASVDRVDVPLLRYEMPNGERRVKVD
AAGKASLTTFRCLEHYAGYSLVEASPITGRTHQIRVHSAWAGHPIAGDDKYMDDVSLKAF
RSIGGQRLMLHARALEFTLPVSGEAMRLEAPYDDAFNDVLRKLSGRLKGNDQ