Protein Info for HP15_2220 in Marinobacter adhaerens HP15

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00702: Hydrolase" amino acids 3 to 178 (176 residues), 88.4 bits, see alignment E=1.7e-28 PF12710: HAD" amino acids 6 to 175 (170 residues), 49.2 bits, see alignment E=1.8e-16 PF13419: HAD_2" amino acids 6 to 184 (179 residues), 108.9 bits, see alignment E=6.5e-35 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 82 to 178 (97 residues), 34.1 bits, see alignment E=3.5e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 123 to 184 (62 residues), 34.3 bits, see alignment E=2.5e-12 PF13242: Hydrolase_like" amino acids 139 to 209 (71 residues), 58.3 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 84% identity to maq:Maqu_1874)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFR4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>HP15_2220 HAD-superfamily hydrolase, subfamily IA, variant 3 (Marinobacter adhaerens HP15)
MNVRVVIFDWDGTLVDSVEHIADSLHQAATELGFPALEREAYRDIIGLGMVEALEKLYPG
ISREEMNRIRDGYGRYFFSKVTTPQNVFEGMADVVADLRGSGRSCSVATGKSRRGLDFAL
ASSGLGDHFEITRCADETRSKPDPAMLEEILRFYRIEPEEAVMIGDTRYDLDMARRIGMP
SIGVEWGVHKRDVLGDYSPHAIVESVPDLRRVLGL