Protein Info for Psest_2312 in Pseudomonas stutzeri RCH2

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 15 to 61 (47 residues), 49 bits, see alignment 4.6e-17 amino acids 109 to 154 (46 residues), 43.7 bits, see alignment 2e-15 PF00924: MS_channel_2nd" amino acids 213 to 270 (58 residues), 24.6 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_2043)

Predicted SEED Role

"CmpX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJA8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Psest_2312 Small-conductance mechanosensitive channel (Pseudomonas stutzeri RCH2)
MEFDPWTQSLLAAMSSLWASVAGFIPRLFGALVVVLLGFVVAKLLDTLLSKVLAKVGLDR
LMAGTGLTKLLGRAGIRIPVSALIGKVVYWFVLLIFLVSAAESLGLERVSATLDMLALYV
PKVFGAALILLAGVLLAQLLSGLVRGAAESVGLDYANGLARMAQGLVIIISISVAIGQLE
VKTELLNYVIAIVLITVGLAVALAFGLGSRELVAQILAGIYVRELYEVGQRVSLGDLEGQ
IEEIGTVKTLLLTDDGELASVANKVLLEQRVGSR