Protein Info for Psest_2310 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05736: OprF" amino acids 1 to 186 (186 residues), 259.8 bits, see alignment E=2.8e-81 PF13505: OMP_b-brl" amino acids 14 to 183 (170 residues), 39.6 bits, see alignment E=1.3e-13 PF03922: OmpW" amino acids 47 to 160 (114 residues), 24.5 bits, see alignment E=4.7e-09 PF00691: OmpA" amino acids 224 to 319 (96 residues), 88.7 bits, see alignment E=5.5e-29

Best Hits

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 93% identity to psa:PST_2045)

Predicted SEED Role

"Major porin and structural outer membrane porin OprF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLF8 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psest_2310 Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Pseudomonas stutzeri RCH2)
MKLKNTLGVVIGSMVAATSLSALAQGQGAVEVEAFGKHYFTDSSRDVQRDGELYGAGVSY
FLTDDVSLGLSYGEYHDLTSKDPVGVDGGHKNIKGSLTSLDAAYHFGAPGVGLRPYVSAG
VAHQSIGQADRGGRDSSTFANVGTGLKYYFTENFFAKASVDGMYNIDADEAEWMAGVGVG
LNFGGGARQVAAVEPTPEPAPAPIVDTEPEPAPELVRVELDVKFDFDKSRVREESYSDIK
NLADFMQQYPQTSTTVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVEGGRVNSVGY
GESRPVADNSTEEGRQINRRVEAEVEAQVQ