Protein Info for PGA1_c02370 in Phaeobacter inhibens DSM 17395

Annotation: putative ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 92 to 119 (28 residues), see Phobius details amino acids 158 to 174 (17 residues), see Phobius details amino acids 199 to 229 (31 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 79 to 334 (256 residues), 83.9 bits, see alignment E=8.3e-28 PF03631: Virul_fac_BrkB" amino acids 89 to 337 (249 residues), 178.2 bits, see alignment E=1.3e-56

Best Hits

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETH5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PGA1_c02370 putative ribonuclease BN (Phaeobacter inhibens DSM 17395)
MPSQPDNRGDASREAASTVDYTEDGTPVTDDFANATPQGRDALRPDGAAGDGSVAANQGR
LSTATGWLGRLPSSVKLLWCAWTRMGNAHGGLLAAGVAFYGLLSVFPGITAFVALFGLIA
DPTLITEQSTWLTSLLPSSAAELVNQQLVQVAGARPDTLGWAAAASAALALWSASRSTDS
VIQGLNVIFGTKEQRSFIVLKAVIVTITFAAICGALLLLLIVAAIPAAVALFGDSALLAG
ITQLLRWPLMFVVGIAGISLLYRFGPDRSGEGWQLFTPGAILSCTLWVAGSIGFSLYVQA
FGSYNETFGALSGVILLLTWMWLSAFVILFGAGLDAERRANTETDCAPLSAEAEGGPEVR
DGQSSSFAA