Protein Info for HP15_2204 in Marinobacter adhaerens HP15

Annotation: membrane protein containing DUF81

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 50 to 64 (15 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 137 to 163 (27 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 10 to 245 (236 residues), 133.6 bits, see alignment E=4.8e-43

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFP8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HP15_2204 membrane protein containing DUF81 (Marinobacter adhaerens HP15)
MTVLEIVALLSIGGIAGFINVLSAGGSMLTLPLLMFLGLPPQVANGTNRVAITLQSITAV
GSFYRMGHGNLVVSLHLAIPAVLGSLVGAWVATWVSDAVFEWVLVSAMIGASVFMLLPQP
VLNTRPLTPERLGPAVYLAMFVVGMYGGFIQVGVGVLFLVVLYHMLKIDLRQVNVLKVSI
VLPFTFAALVVFALNDQVRWGVGLTLALGNVTGAFIATRVNMSKRGARWIKGITLVMVAA
ILVRLVIY