Protein Info for Psest_2296 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00392: GntR" amino acids 12 to 74 (63 residues), 69.2 bits, see alignment E=1.9e-23 PF07729: FCD" amino acids 96 to 216 (121 residues), 86.2 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 78% identity to psa:PST_2058)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN68 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_2296 Transcriptional regulators (Pseudomonas stutzeri RCH2)
MSLQYTSRSSLVERVIEQMRSQINAGEWLPGMRIPTESQLSDSLGVGRNTVREAVRALVH
TGVLEVRQGAGTFVLSSRDPSGLLQSLDHAALHDQLEVRRALEVEAARLAASRRTDEDLR
AIHDALGARGTWSDEASLEAFVERDADFHLSIVRASHNATLLEMYQFFWAGLQNTIAKTE
GEQQLPEPTYAAHAAVYDAIARGYPEQAAIAASELLSPALEALASTLAIDSRNPDATE