Protein Info for PGA1_c02340 in Phaeobacter inhibens DSM 17395

Annotation: putative mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 113 to 175 (63 residues), 70.8 bits, see alignment E=8.6e-24 PF21082: MS_channel_3rd" amino acids 187 to 271 (85 residues), 37.3 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 69% identity to dsh:Dshi_4182)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX02 at UniProt or InterPro

Protein Sequence (296 amino acids)

>PGA1_c02340 putative mechanosensitive ion channel (Phaeobacter inhibens DSM 17395)
MSVTEDLSMTLMEQMSDWLASAVIALPRVGVALTILLLTALLVWAAKTVIRRISRQLKLR
RNLCDVLQLLASVILWLIGSLIAVTVVFPTVTPGKALTTLGLGSVAIGFAFKDTFENFLA
GILLLLREPFQIGDFIECEGAEGKIEAITVRDTHIRQTDGQLVVVPNAQLFHNAVTVRTN
RELRRATLICGIAYGENVDTARSVISEAVRNVDMVRDDVRDVQVFAKTFGASSIDFEITW
WTGSEPLDIRASRDQVVAAVKTALDDAGIEIPFPYRTLTVNEPIPVQIDGQHDDRE