Protein Info for Psest_2269 in Pseudomonas stutzeri RCH2

Annotation: Dipeptidyl aminopeptidases/acylaminoacyl-peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF20434: BD-FAE" amino acids 415 to 597 (183 residues), 29 bits, see alignment E=2.3e-10 PF00326: Peptidase_S9" amino acids 432 to 634 (203 residues), 165.3 bits, see alignment E=4.4e-52 PF01738: DLH" amino acids 474 to 620 (147 residues), 35.5 bits, see alignment E=2.5e-12 PF07859: Abhydrolase_3" amino acids 474 to 616 (143 residues), 30.3 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 75% identity to psa:PST_2077)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F (EC 3.4.99.-)" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.99.-

Use Curated BLAST to search for 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ70 at UniProt or InterPro

Protein Sequence (637 amino acids)

>Psest_2269 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases (Pseudomonas stutzeri RCH2)
MSCTNTRPTPDSIPYGFWPSDWSAEAAAVASRDFAELRAGHGGLYWIEYDPSHGRCTLWL
WRGGNAHCLTPERFSVRSRVYEYGGGAFCLTSEGLAFVNEEDQQIHLQATESTGGAAHPV
ALTDRSGCRYGDLQHDQHAEAIIALEESHGAEGVEHRLVSLTIADGGREVLVEGADFYSS
PVLSPDGTRLAWIEWDRPEQPWTATRLCVATRMPDGRWGGRQVLAGAAGGESLQQPRFAA
DGRLHCLSDRSGFWQPWVEADGKLVRPSSLAQACGDYDCAPAPWQLGTSSYLPLHDGALL
LTHMVDGYGWLFEHANNGDQRQLATEFTRCRQLSANESHVFCIAGSPERTPAVLAIERAS
GALQILAGGAMPLVTDQLSCPQPLRFATGGDEVAHAFFYPPRNAHCHGPTATLPPLVVFA
HGGPTSASYPVFDPRIQFWTQRGFAVVDVNYRGSSGFGRAYRQRLREQWGVVDVEDACQA
VRALVGQGEIDSQRVFIRGSSAGGYTALSALAATDLFRGGASLYGVSDPLALRRATHKFE
GDYLDWLIGDPRLVSERFRERAPLYNAERINAPVIFLQGGQDAVVLPEQTESMVAALRSR
GVTVDYRLYPDERHGFRQAANLADALERELRFYQCLL