Protein Info for HP15_2156 in Marinobacter adhaerens HP15

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01060: phosphopyruvate hydratase" amino acids 2 to 404 (403 residues), 622.4 bits, see alignment E=1.7e-191 PF03952: Enolase_N" amino acids 2 to 114 (113 residues), 139.2 bits, see alignment E=9.7e-45 PF00113: Enolase_C" amino acids 125 to 405 (281 residues), 441.7 bits, see alignment E=1.3e-136

Best Hits

Swiss-Prot: 68% identical to ENO_PSEA6: Enolase (eno) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 68% identity to pat:Patl_3266)

MetaCyc: 64% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.11

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF40 at UniProt or InterPro

Protein Sequence (413 amino acids)

>HP15_2156 phosphopyruvate hydratase (Marinobacter adhaerens HP15)
MEVDVELRNGVVGQGRVPSGASTGTREALEKRDCDDRRYNGKGVLQAVRCVNECIAPALE
GRVVFDQLVMDRLMCEMDGTPNKAEFGANAILAVSLATANAGANYRQQPLYRYLAELYGC
NGPSILPVPMMNIINGGAHADNNVDIQEFMIQPVGAPSYSEALRMGVETFHALKALLRKN
GLSTAVGDEGGFAPNLRSSEEALDLILAAIEKAGYRPGSDVVLALDCAASEFYEDGHYNL
KSAGKQFTSEEFSDYLLDLAMKYPIASIEDGMDESDWDGWKLLTEKLGERVQLVGDDLFV
TNTSIITEGIRKGIANSVLIKFNQIGTLTETLDAIGMAQDSGYTTVISHRSGETEDTFIS
DLAVATRSGQIKTGSLCRSDRVAKYNRLLRIEQDLGAHAFYPGVGAIRCALDT