Protein Info for HP15_2144 in Marinobacter adhaerens HP15

Annotation: redoxin domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00578: AhpC-TSA" amino acids 29 to 144 (116 residues), 103.9 bits, see alignment E=1.8e-33 PF08534: Redoxin" amino acids 30 to 161 (132 residues), 105.5 bits, see alignment E=6.9e-34 PF13098: Thioredoxin_2" amino acids 52 to 152 (101 residues), 36.5 bits, see alignment E=1.5e-12 PF13905: Thioredoxin_8" amino acids 52 to 141 (90 residues), 67.3 bits, see alignment E=3.8e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to maq:Maqu_1818)

Predicted SEED Role

"thioredoxin family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF28 at UniProt or InterPro

Protein Sequence (167 amino acids)

>HP15_2144 redoxin domain protein (Marinobacter adhaerens HP15)
MVMKASIKSLAVAGVLACLSPMAGAEAINVPAPDFTLESRSGENLRLEDHRGEVVMLNFW
ASWCGPCRQEMPLMDELYSQYKDLGFTILAVNVDENREEAHRFLDKVPVNYPILYDPESS
VSELYEVQAMPTTVMIDRDGNARYLHYGYQPGYEDEYEQQIRELVRE