Protein Info for HP15_2137 in Marinobacter adhaerens HP15

Annotation: biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 116 to 143 (28 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 75 to 195 (121 residues), 99.3 bits, see alignment E=7.3e-33

Best Hits

KEGG orthology group: None (inferred from 97% identity to maq:Maqu_1810)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF21 at UniProt or InterPro

Protein Sequence (235 amino acids)

>HP15_2137 biopolymer transport protein (Marinobacter adhaerens HP15)
MIDTAVRFFQEGGFFMFPIAVVLIVGLIVAIERYVYLSAQKLTNRRDFNRLHQMIAKRDL
KGALNYTQESGSAMSTMIGFGLQRLARRQGREEIEYAMEEGLLDVMPRLEKRTQYLATLA
NIATLLGLLGTIIGLIAAFTAVAAADPAQKASLLSQSISVAMNTTAFGLMSAIPMLLIHS
LLQTKTNEIVDSFEMAGIKVLNLLSDGSGSKTAAQPQGQNAAAPAQVATPAGSPA