Protein Info for PGA1_c02290 in Phaeobacter inhibens DSM 17395

Annotation: putative NAD dependent epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 4 to 153 (150 residues), 70.8 bits, E=3.1e-23
• PF01370: Epimerase
  • amino acids 5 to 212 (208 residues), 94.4 bits, E=2.3e-30
• PF16363: GDP_Man_Dehyd
  • amino acids 34 to 232 (199 residues), 87.5 bits, E=3.6e-28
• PF02719: Polysacc_synt_2
  • amino acids 35 to 233 (199 residues), 23.1 bits, E=1.2e-08
• PF01073: 3Beta_HSD
  • amino acids 35 to 136 (102 residues), 24.1 bits, E=5.3e-09
• PF07993: NAD_binding_4
  • amino acids 52 to 164 (113 residues), 23.5 bits, E=8.8e-09

Best Hits

KEGG orthology group: None (inferred from 60% identity to sit:TM1040_1485)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See I7DWZ8 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PGA1_c02290 putative NAD dependent epimerase/dehydratase (Phaeobacter inhibens DSM 17395)
MSRRIFLTGSGGVVGRHALRALETLAPDAEVLRNTADLTNPHEVAQAIERVGPLDLVIHL
AAIVPVQSVRANPGAAFAVNAGGTINLLTALDGSPARMLLCSSSHVYASQETPLRETDTT
EPVSLYGQTKLMSEQAARQICAATGRSLCIARLFSIHDPHQTGSYLRPTLEKRFATHSPE
APFELHGAGSRRDFLPASEAARLITELALSEAEGPVNVASGNAMTVADFAQAIAPFPLNI
RPVGQNDTLEADVTRLRAILGERHD