Protein Info for HP15_2128 in Marinobacter adhaerens HP15

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 793 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details amino acids 661 to 684 (24 residues), see Phobius details amino acids 716 to 739 (24 residues), see Phobius details amino acids 758 to 780 (23 residues), see Phobius details PF02687: FtsX" amino acids 275 to 394 (120 residues), 62.1 bits, see alignment E=2.6e-21 amino acids 669 to 783 (115 residues), 58.4 bits, see alignment E=3.8e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 69% identity to maq:Maqu_1012)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF12 at UniProt or InterPro

Protein Sequence (793 amino acids)

>HP15_2128 ABC transporter, permease protein (Marinobacter adhaerens HP15)
MSPKGLNTVLNVKLRRELWQMRGQVLAIALVIAGGVGVCVMSLVNYSSLLATRAQYYEQH
EFAEVFAPVKRAPRHTLKDIAALPGIARYEGRVEGAAKLEIPGFPDPVSARLVSVPPEGQ
PDVNRLFIRQGRLPAAGRSQEIAVIGSFAEAHELVLGDQFEAIINGRRQALTITGIVESP
EFIYVIPPGGMLPDYQRYGVLWMNRESLESAMDMRGAFNSLVVTLKPGHSAASVIDALDR
LLARYGATGAFGRDDQFSHRFLSDELNQLKTMATVFPLIFMSVAMFLLNVVIGRLISTQR
DIVAVLKAFGYSNRQIAWHYSKLVIVIAVIGLLAGLGLGLWLGRSLGELYMDYYRFPGLL
FRIDPAWVVLLGLMTIVVAWLGAWRAIRQAAALPPAEAMRPEGPARYRVTIVEKLLSGIR
FAQPSRMIVRQLSRRPVRTLLSMTGVAMATAIVMVGNFQFDSVSLMVHTQFARVQQQDLS
ATFIDPVNSAALFGLQRQAGIRYVEGRRSVPARLVSGHREWRSAVTGIPSEARLQFVIDS
DLQPVPLPREGLLLTDFLADELGVGPGDVLQLELLEGDRRTVMVPVAGITSEFLGVGAYM
DLDALNRALGDGPLINQALINLDPDKASEVYNSLRETPGVLGLSIRQAMLDSFYDTLART
FLTFTFFNSLMGGIIAFGVVYNTIRISLAEKGRELASLRVLGYTQNEVAHILLGEVALLL
FLGIPLGWLIGQGLALMIVTAMQTELYRVPLTITSQTLGMSALVVVVSAIASGAIAWWRL
KRLDLVAVLKTRE