Protein Info for PGA1_c22030 in Phaeobacter inhibens DSM 17395

Annotation: 5-bromo-4-chloroindolyl phosphate hydrolysis protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details PF10112: Halogen_Hydrol" amino acids 132 to 291 (160 residues), 95.9 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: None (inferred from 68% identity to sit:TM1040_1928)

Predicted SEED Role

"FIG01073209: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2D6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PGA1_c22030 5-bromo-4-chloroindolyl phosphate hydrolysis protein. (Phaeobacter inhibens DSM 17395)
MAQRFGGKYSPDGRDTGADKAPTSDHTTSSANSYRSAKVDPVGMRANLMALPAGLVALMS
VFSDAAGLAFGLLAAATWAGSAYLLRDGLRAEAAYDDRKVARRPALPRKILAALLCGIGA
LFAVWRQDPGALSALIYAAAATGLHLAAFGVDPLRDKGTEGIDDFQRDRVARVVDEAETY
LSAMKDAALRARDRKVEQQVEAFQEVARDLFRTVEEDPRDLTGARRYLTVYLMGARDATI
KFADIYTRSGDIQARQDFLALLTDLEQNFAARTRKMLLEDRTDLTVEIDVLRDRLQREGV
HLDTR