Protein Info for PGA1_c21860 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Histidinol-phosphatase [alternative form] (EC 3.1.3.15)
Rationale: Annotated as this by multiple resources. (essential) (SEED_correct)
Original annotation: putative histidinol-phosphate phosphatase HisN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 72% identity to sil:SPO2958)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYC0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_c21860 Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (Phaeobacter inhibens DSM 17395)
MADAARQAILPYFRSAGLQSDNKLDEGFDPVTIADRAAEQAMRSVLSELRPEDSILGEEF
GETHGQSGRTWVLDPIDGTRGFISGTPTWGVLIALGDADGPFLGIVDQPYIGERFIGTPE
GASLTGPLGHSALVTRATDSLSEATLFTTFPEVGTEAERAAFQRVSAQVRLTRYGMDCYA
YALLAAGQCDLVIEAGLNAYDIQAPIAVIQAAGGVVTNWQGEPAHEGGQVLAAATAELHA
AALALIQQTA