Protein Info for PGA1_c21800 in Phaeobacter inhibens DSM 17395

Annotation: putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 113 to 145 (33 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 415 to 442 (28 residues), see Phobius details amino acids 462 to 480 (19 residues), see Phobius details amino acids 487 to 487 (1 residues), see Phobius details amino acids 490 to 511 (22 residues), see Phobius details amino acids 520 to 538 (19 residues), see Phobius details amino acids 545 to 563 (19 residues), see Phobius details amino acids 583 to 603 (21 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 27 to 188 (162 residues), 30.2 bits, see alignment E=3.7e-11 amino acids 466 to 604 (139 residues), 29.1 bits, see alignment E=8.3e-11 PF03600: CitMHS" amino acids 37 to 552 (516 residues), 227.2 bits, see alignment E=4.7e-71 PF02080: TrkA_C" amino acids 241 to 308 (68 residues), 32.1 bits, see alignment E=1.4e-11 amino acids 326 to 393 (68 residues), 46 bits, see alignment E=6e-16

Best Hits

KEGG orthology group: None (inferred from 84% identity to sit:TM1040_1899)

Predicted SEED Role

"TrkA domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DS28 at UniProt or InterPro

Protein Sequence (605 amino acids)

>PGA1_c21800 putative transporter (Phaeobacter inhibens DSM 17395)
MIDLSTSWMSLPLMQFLPLGETGGAVLTLLIVVAMFAAFLRETFPTEVVALAGVSVMLAT
GVLPYQAALPVLSNPAPWTIAAMFIIMGALVRTGALDAFTAQARKQAEVNPKLAIALLMV
FVVAASAVVSNTPVVVVMIPVFIQISRTMKVSASKMLIPLSYAAILGGTLTLIGTSTNLL
VDGVARAQGLAPFTIFEVTPLGIILVIWGMIYLRFIAPRLLPDRSSMASLLSDRSRMKFF
TEAVIPPESNLIGREVTGVQLFKRQGVRLIDVIRGDISLRNALKGVELQVGDRVVLRTQM
TELLSLQRNKELKRVDQVSTVETETVEVLITPGCRMVGRSLGAMRLRRRYGVYTLAVHRR
NQNIGVQLEDLVVRVGDTLLLEGNAEDIQRLAADMDMAAVSQPSVRAYRRRHAPIAIVAL
IGIVVLAALGVAPILLLSVLAVSTVLITRCIDADEAFSFVDGRLLTLIFAMLAIGAALES
SGAVRLIVDAVAPSLSMLPPFLLVWAVYLLTSILTELVSNNAVAVVVTPIAVGLAQAMGI
DPRPLVVAVMVAASASFATPIGYQTNMLVYGPGGYKFTDFLRVGIPLNFSVGLLASILIP
VFWPL