Protein Info for HP15_2101 in Marinobacter adhaerens HP15

Annotation: membrane protein containing cytochrome c assembly protein, transmembrane region domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 208 to 234 (27 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 332 to 361 (30 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 428 to 451 (24 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details PF11412: DsbD_N" amino acids 51 to 164 (114 residues), 103.9 bits, see alignment E=1.8e-33 PF02683: DsbD_TM" amino acids 208 to 426 (219 residues), 276.2 bits, see alignment E=4.7e-86 PF13386: DsbD_2" amino acids 214 to 417 (204 residues), 45.5 bits, see alignment E=2.6e-15 PF13899: Thioredoxin_7" amino acids 520 to 600 (81 residues), 62.2 bits, see alignment E=1.2e-20 PF13098: Thioredoxin_2" amino acids 522 to 626 (105 residues), 56.4 bits, see alignment E=1.1e-18 PF00085: Thioredoxin" amino acids 530 to 619 (90 residues), 29.7 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 78% identity to maq:Maqu_1778)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRF6 at UniProt or InterPro

Protein Sequence (631 amino acids)

>HP15_2101 membrane protein containing cytochrome c assembly protein, transmembrane region domain (Marinobacter adhaerens HP15)
MMAFAAVTTIKRQWANPLGLILALALVCLSSPSAWALGGNGGLLFGGQGSDFLPVDEALP
FSFSTNADTVVLSWNITPGHYLYRDRISITATNPEVSLGEPTFSAPGTVTEDEFFGKTTV
FFDPVDARVPVALPAGLREAELQVTYQGCAKAGLCYPPQTRDVLFYQGSGGSGSQTAATP
GFASGDSVPVDTETATGLAGFLAQQSTLVIAGVFLLLGLGLTFTPCVLPMVPIISSLVSG
RNTRTTGHALLLSGSYVLGMALTYAAAGVLTGLLGASFNLQAQLQSPWVLSVFALMFVVF
ALSMFDLFEIQLPRFIREPLNDASHRLTGSRVFSIFGIGALSALIVSPCVSAPLAGSLLY
ISTTQDAVIGGVALFALGLGMGIPLILVAVGGRKLLPTTGHWMTAVKHFYGVMLLAVAIW
LVERLVPGWLALTLWGLLVAITGVQLGAFDAAKAGWERTRKGLGLVLFAYGLALLAGAVG
GANDPLKPLAPFTIASASSGGIGTAGIQHADFVRVERPADIQAMLEQAREQGRPVLLDFY
ADWCISCKVMERNVFSKPDVIQALSPFTLLQIDMTDNTPEQQAMLDELGLFGPPAILFYG
SNGQELAQRRVLGEMDREEFLGHLQTLQPEV