Protein Info for PGA1_c21730 in Phaeobacter inhibens DSM 17395

Annotation: putative arginine exporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 24 (3 residues), see Phobius details amino acids 36 to 68 (33 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details PF01810: LysE" amino acids 13 to 200 (188 residues), 123.6 bits, see alignment E=3.8e-40

Best Hits

Swiss-Prot: 46% identical to Y2008_MYCBO: Putative amino-acid transporter Mb2008 (BQ2027_MB2008) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 70% identity to sit:TM1040_1890)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2B4 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PGA1_c21730 putative arginine exporter protein (Phaeobacter inhibens DSM 17395)
MPPSLIAGFFLGLSLIMAIGAQNAFVLRQGLRRQHVFWICFTCASSDALLITAGVLGFGS
LALAVPWFELAMRLGGAAFLLWYGARSLMAAWRGGAHLDSADGQGAPVTLWPMLATVLAL
TWLNPHVYLDTVVLLGSISAQYPQPLVFGFGAAVSSFVFFFTLGYGASFLAPVFARPRAW
QVLDVLVGLTMWAIALKLLLM