Protein Info for PGA1_c21690 in Phaeobacter inhibens DSM 17395

Annotation: transporter, BCCT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 82% identity to sit:TM1040_1884)

Predicted SEED Role

"Choline transporter BetT, short form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0R8 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PGA1_c21690 transporter, BCCT family (Phaeobacter inhibens DSM 17395)
MTTIISAGILLAFALVIFCVIKWWNMRIVGVTPVPLFTFIAILFTSGLDVGLIMFPLAFD
YPLYADTAAEPAYAFTNPLALEFGFWGFLIWAFYFLTSFYFCAIEPRVKFFEIGIVKLLN
NLVIITTCAFTGALFLIYMPYYIAEVGDGETVIPAFYVICFLVILAAAYSSTDIKYVRIL
SVGSTFLFFALILGMWAYAGMGLGEFVSTAGNIGGYFGNIHKFILPLTEYHEFYLFWWFA
WSIMIGQFTSRFVGGLTTWQLLAALLVFPSIPLAVWFSVLYFYHLNTIPTAGLINWSMTV
VGILFVINSFDSLIRLYTDNMNLSAERLGKLPYVLGNAVALFALTLAFQSQWLQIQWVGT
VVIGIYIACLIYIFVKKRGEVAAITTSPEENTLDFDRIKTAH