Protein Info for HP15_2086 in Marinobacter adhaerens HP15

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02540: NAD_synthase" amino acids 14 to 128 (115 residues), 25.2 bits, see alignment E=2.1e-09 PF02568: ThiI" amino acids 16 to 85 (70 residues), 20.5 bits, see alignment E=7.8e-08 PF03054: tRNA_Me_trans" amino acids 17 to 214 (198 residues), 264.2 bits, see alignment E=1.9e-82 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 17 to 371 (355 residues), 435.6 bits, see alignment E=6e-135 PF20259: tRNA_Me_trans_M" amino acids 219 to 284 (66 residues), 76.3 bits, see alignment E=2.7e-25 PF20258: tRNA_Me_trans_C" amino acids 297 to 371 (75 residues), 82.5 bits, see alignment E=5.8e-27

Best Hits

Swiss-Prot: 90% identical to MNMA_MARHV: tRNA-specific 2-thiouridylase MnmA (mnmA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 90% identity to maq:Maqu_1762)

MetaCyc: 67% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRE1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>HP15_2086 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (Marinobacter adhaerens HP15)
MTNAPEASSPNSNANTRVIVGMSGGVDSSVAAWLLKDQGYQVEGLFMKNWDEDDGTEYCT
AMTDLADAQAVADAIGIKLHTASFAAEYWDRVFEHFLSEYQAGRTPNPDILCNKEVKFRA
FLDYAITLGADYIATGHYARQRPIAGSTGKAQLLKGLDPNKDQSYFLHAVSGDRIARTLF
PVGELEKPEVRRIAEQQGFVTHDKKDSTGICFIGERKFKDFLKQYLPAQPGDIETPDGQK
IGRHQGLMYHTIGQRQGLGIGGLSEFGDEPWYVAEKDLSRNVLVAVQGKHHPLLFSRGLV
SGPIDWVAGEAPAGHFRCKAKTRYRQPDQDCQVLLIDGGVRVDFDDAQRAVTPGQSVVFY
DGEVCLGGGVIEQTWRDDEPLPDRLTGTRSEEQTA