Protein Info for PGA1_c21620 in Phaeobacter inhibens DSM 17395

Annotation: putative bicyclomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 19 to 391 (373 residues), 259.2 bits, see alignment E=4.5e-81 PF07690: MFS_1" amino acids 20 to 360 (341 residues), 161 bits, see alignment E=6e-51 PF00083: Sugar_tr" amino acids 49 to 176 (128 residues), 26.2 bits, see alignment E=5.7e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 68% identity to sil:SPO1093)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ENM3 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PGA1_c21620 putative bicyclomycin resistance protein (Phaeobacter inhibens DSM 17395)
MRTIPRRFLDRRSNPNIGTLILLSGLSALAMNIFLPSLPGMARYFDADYSLMQLSVALYL
AVSAIVQIFVGPISDKLGRRPVILWGVALFLLATLGCLYAPSAEIFLLFRMCQAIVASAM
VLSRAAVRDIYDSDQAASMIGYVTMGMAVVPMIGPMIGGALEETIGWKANFWLLMALGAG
TFAIAYLDLGETARKSGKTLMAQFREYPELLRSPRFWGYSLASGLSSGAFFAYLGGAPFM
GTQVYGLSAAQLGVYFASPAVGYFVGNFLSGRYSVRIGLNQMVLWGCLINGVGVALSLVL
ALLGADSVYSFFGFMTFVGLGNGMAIPNATAGAISVRPHLAGTASGLAGAIMIGVGAGLS
AYAGYLLVPGSTPVPLLAIMLGTAVLGFISIRVVIRREKTLGL