Protein Info for PGA1_c21525 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13778: DUF4174
  • amino acids 93 to 194 (102 residues), 64.8 bits, E=5.4e-22

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1)" in subsystem Propionyl-CoA to Succinyl-CoA Module (EC 5.1.99.1)

MetaCyc Pathways

• methylaspartate cycle (15/19 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (7/14 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 5.1.99.1

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

See I7ENL7 at UniProt or InterPro

Protein Sequence (201 amino acids)

>PGA1_c21525 hypothetical protein (Phaeobacter inhibens DSM 17395)
MKHLFVFGKTRFGPAEPLLGSAGILGLAALLAMGLPSAGVAQQAAAAAADDSAIVAEETG
SQGARDAETMAEVADPPTDPLVQLVRPGASVELDDLMWLHRPIVVFADSPADPRFHEQME
RLADGAEALLERDVIVLTDTDPGVTSALRKKLRPRGFMLVLIGKDGGVKLRKPQPWTVRE
LSRTIDKFPSRLREVEERRGS