Protein Info for HP15_2074 in Marinobacter adhaerens HP15

Annotation: carbon-nitrogen hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 12 to 285 (274 residues), 215.1 bits, E=5.6e-68

Best Hits

Swiss-Prot: 45% identical to AGUB_SOLLC: N-carbamoylputrescine amidase (CPA) from Solanum lycopersicum

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 84% identity to maq:Maqu_1751)

Predicted SEED Role

"N-carbamoylputrescine amidase (3.5.1.53)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

See E4PRC9 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HP15_2074 carbon-nitrogen hydrolase family protein (Marinobacter adhaerens HP15)
MSSELRKSQINVAVIQQACSSDKAASLATTEKLVREAVASGANLVILQELHATLYFCQTE
ETSVFELAEPIPGPTSKRLSDLARELGIVLVGSIFERRMNGVYHNTAVVFEKDGSLAGLY
RKMHIPDDPGFYEKFYFTPGDAQFNDGRSGFTPIDTSVGRLGVLVCWDQWYPEAARLMAL
AGAEILIYPTAIGWDVTDDPDEQARQLDAWVTVQRGHAVANNLPVVAPNRVGTEPDPSGH
SDGIRFWGNSFICGPQGELLARGDDSSECILAVTLDRSRSESVRRIWPYLRDRRIDAYGD
ILKRVRD