Protein Info for PGA1_c02170 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 97 to 215 (119 residues), 67 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_0314)

Predicted SEED Role

"COG0398: uncharacterized membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWZ3 at UniProt or InterPro

Protein Sequence (267 amino acids)

>PGA1_c02170 Uncharacterized conserved protein (Phaeobacter inhibens DSM 17395)
MSDQSDQPDIADRSGGVAPASESGGRGKKTPALTRFLPLALVLVVAVIGAMTLGDYLTFE
TLRDNRVALMAFRDDNYLGLVGLFVLAYVVIVVFSLPGAAVASVTGGFLFGLVAGTVFNV
LAATVGAVGIFLAARWGLGAMLTHRLEAAEGRVRILKQALRENEIEVLLLLRLVPAVPFF
VANLLPALVGVKLVHFLWTTAVGIIPGAIVFTWIGVGLGAVFDRGGTPDLSILWEPFVIG
PILGLCVLAALPILLKKRRPAVPGKEQ