Protein Info for PGA1_c21490 in Phaeobacter inhibens DSM 17395

Annotation: putative N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF13302: Acetyltransf_3" amino acids 2 to 134 (133 residues), 34 bits, see alignment E=1.1e-11 PF13420: Acetyltransf_4" amino acids 3 to 153 (151 residues), 58.3 bits, see alignment E=2.5e-19 PF13673: Acetyltransf_10" amino acids 28 to 139 (112 residues), 36.7 bits, see alignment E=9.8e-13 PF00583: Acetyltransf_1" amino acids 35 to 133 (99 residues), 52.2 bits, see alignment E=1.9e-17 PF13508: Acetyltransf_7" amino acids 49 to 135 (87 residues), 36.8 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 60% identity to sil:SPO1107)

Predicted SEED Role

"phosphinothricin N-acetyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E293 at UniProt or InterPro

Protein Sequence (174 amino acids)

>PGA1_c21490 putative N-acetyltransferase (Phaeobacter inhibens DSM 17395)
MIVRAATAADAEAIAAITNQIIRDTLITFTTAEKTSEQVRDEIAEKGAYVQVAEEAGQIL
GYISLGAFRTGPGYARTCEHAIYLAETARGRGAGRALIAAIEAVARADGVHVLVAGISAV
NAGGLAFHAAMGFVEVGRMPEVGHKADQWLDLVLMQKILSPKGVGPADSPVKSG